SpermatogenesisOnline 1.0
 

Tag Content
SG ID
SG00000133 
UniProt Accession
Theoretical PI
5.32  
Molecular Weight
60310 Da  
Genbank Nucleotide ID
Genbank Protein ID
Gene Name
mod 
Gene Synonyms/Alias
ORFNames=CG2050 
Protein Name
DNA-binding protein modulo 
Protein Synonyms/Alias
 
Organism
Drosophila melanogaster (Fruit fly) 
NCBI Taxonomy ID
7227 
Chromosome Location
chr:3R;27877794-27880696;1
View in Ensembl genome browser  
Function in Stage
Function in Cell Type
Description
Temporarily unavailable 
The information of related literatures
1. L. M. Mikhaylova, A. M. Boutanaev and D. I. Nurminsky (2006) Transcriptional regulation by Modulo integrates meiosis and spermatid differentiation in male germ line. Proc Natl Acad Sci U S A 103(32): 11975-80. 

Abstract
Transcriptional activation in early spermatocytes involves hundreds of genes, many of which are required for meiosis and spermatid differentiation. A number of the meiotic-arrest genes have been identified as general regulators of transcription; however, the gene-specific transcription factors have remained elusive. To identify such factors, we purified the protein that specifically binds to the promoter of spermatid-differentiation gene Sdic and identified it as Modulo, the Drosophila homologue of nucleolin. Analysis of gene-expression patterns in the male sterile modulo mutant indicates that Modulo supports high expression of the meiotic-arrest genes and is essential for transcription of spermatid-differentiation genes. Expression of Modulo itself is under the control of meiotic-arrest genes and requires the DAZ/DAZL homologue Boule that is involved in the control of G(2)/M transition. Thus, regulatory interactions among Modulo, Boule, and the meiotic-arrest genes integrate meiosis and spermatid differentiation in the male germ line. PMID: [16877538] 

Back to Top
Figures for illustrating the function of this protein/gene
Ref: L. M. Mikhaylova, A. M. Boutanaev and D. I. Nurminsky (2006) Transcriptional regulation by Modulo integrates meiosis and spermatid differentiation in male germ line. Proc Natl Acad Sci U S A 103(32): 11975-80. PMID: [16877538]
Function
Its capacity to bind DNA and protein(s), and itsdifferential expression during development suggest a role in theregulation of gene expression during Drosophila development. Itcould, in interaction with other factors, be required for thetranslation of instructions provided by pattern forming genes andcontrols, via chromatin changes, the activity of genes criticalfor the process of morphogenesis of several embryonic territories. 
Back to Top
Subcellular Location
Nucleus. 
Tissue Specificity
 
Gene Ontology
GO IDGO termEvidence
GO:0005737 C:cytoplasm IDA:FlyBase.
GO:0005730 C:nucleolus IDA:FlyBase.
GO:0043234 C:protein complex IPI:FlyBase.
GO:0003729 F:mRNA binding ISS:FlyBase.
GO:0000166 F:nucleotide binding IEA:InterPro.
GO:0043565 F:sequence-specific DNA binding IDA:FlyBase.
GO:0008283 P:cell proliferation IMP:FlyBase.
GO:0007286 P:spermatid development IMP:FlyBase.
Back to Top
Interpro
IPR012677;    Nucleotide-bd_a/b_plait.
IPR000504;    RRM_dom.
Back to Top
Pfam
PF00076;    RRM_1;    4.
Back to Top
SMART
SM00360;    RRM;    4.
Back to Top
PROSITE
PS50102;    RRM;    4.
Back to Top
PRINTS
Created Date
18-Oct-2012 
Record Type
Experiment identified 
Protein sequence Annotation
CHAIN         1    542       DNA-binding protein modulo.
                             /FTId=PRO_0000081635.
DOMAIN      175    251       RRM 1.
DOMAIN      258    331       RRM 2.
DOMAIN      340    429       RRM 3.
DOMAIN      420    489       RRM 4.
COMPBIAS     60    134       Asp/Glu-rich (acidic).
MOD_RES      42     42       Phosphoserine.
MOD_RES      44     44       Phosphoserine.
MOD_RES     120    120       Phosphoserine.
MOD_RES     129    129       Phosphoserine.
MOD_RES     142    142       Phosphoserine.
MOD_RES     304    304       Phosphoserine.
MOD_RES     330    330       Phosphoserine; by PKA (Potential).
MOD_RES     443    443       Phosphoserine.
CONFLICT     74     74       P -> A (in Ref. 1; CAA33732).
CONFLICT    329    329       I -> V (in Ref. 1; CAA33732).
CONFLICT    505    542       RAPRKFQKDTKPNFGKKPFNKRPAQENGGKSFVKRARF ->
                             APRGSSKRTLSQTLVKNHLTSARHKRMVVNRLLKGQDFRT
                             (in Ref. 1; CAA33732).
Back to Top
Nucleotide Sequence
Length: 2275 bp   Go to nucleotide: FASTA
Protein Sequence
Length: 542 bp   Go to amino acid: FASTA
The verified Protein-Protein interaction information
Other Protein-Protein interaction resources
String database  
View Microarray data
Temporarily unavailable 
Comments