CHAIN 1 264 Transformer-2 sex-determining protein.
/FTId=PRO_0000081986.
DOMAIN 97 175 RRM.
REGION 176 196 Linker.
COMPBIAS 21 90 Arg/Ser-rich (RS1 domain).
COMPBIAS 197 264 Arg/Ser-rich (RS2 domain).
MOD_RES 40 40 Phosphoserine.
MOD_RES 180 180 Phosphothreonine.
MOD_RES 212 212 Phosphoserine.
MOD_RES 214 214 Phosphoserine.
MOD_RES 254 254 Phosphoserine.
VAR_SEQ 1 85 Missing (in isoform MsTmaj).
/FTId=VSP_005900.
VAR_SEQ 2 39 Missing (in isoform Tmin).
/FTId=VSP_005901.
VAR_SEQ 134 264 TQRSRGFCFIYFEKLSDARAAKDSCSGIEVDGRRIRVDFSI
TQRAHTPTPGVYLGRQPRGKAPRSFSPRRGRRVYHDRSASP
YDNYRDRYDYRNDRYDRNLRRSPSRNRYTRNRSYSRSRSPQ
LRRTSSRY -> INP (in isoform MsTmin).
/FTId=VSP_005902.
MUTAGEN 11 82 Missing: In d2; greatly reduced female-
specific DSX splicing.
MUTAGEN 49 82 Missing: In d1; greatly reduced female-
specific DSX splicing. Retains male
fertility.
MUTAGEN 113 123 Missing: In a36; loss of female-specific
DSX splicing. Loss of male fertility.
MUTAGEN 138 138 R->L: In pm1; loss of female-specific DSX
splicing. Loss of male fertility.
MUTAGEN 140 140 F->A: In pm2; no female-specific DSX
splicing. Some low male fertility.
MUTAGEN 151 151 A->V: In ts1; little female-specific DSX
splicing. Loss of male fertility and
temperature-sensitive phenotype.
MUTAGEN 172 264 Missing: In d5; loss of female-specific
DSX splicing. Loss of male fertility.
MUTAGEN 173 173 S->A: In pm3; greatly reduced female-
specific DSX splicing. Retains male
fertility and temperature-sensitive
phenotype.
MUTAGEN 173 173 S->F: In a15, loss of female-specific DSX
splicing and male fertility.
MUTAGEN 173 173 S->T: In pm4; loss of female-specific DSX
splicing. Retains male fertility and
temperature-sensitive phenotype.
MUTAGEN 181 181 P->S: In ts2; temperature-sensitive
phenotype.
MUTAGEN 205 264 Missing: In d4; loss of female-specific
DSX splicing. Greatly reduced male
fertility.
MUTAGEN 236 264 Missing: In d3; greatly reduced female-
specific DSX splicing. Retains male
fertility.
Back to Top