SpermatogenesisOnline 1.0
 

Tag Content
SG ID
SG00000348 
UniProt Accession
Theoretical PI
9.33  
Molecular Weight
56831 Da  
Genbank Nucleotide ID
Genbank Protein ID
Gene Name
Nop60B 
Gene Synonyms/Alias
mfl 
Protein Name
H/ACA ribonucleoprotein complex subunit 4 
Protein Synonyms/Alias
EC=5.4.99.- Nucleolar protein AT band 60B; Protein minifly; 
Organism
Drosophila melanogaster (Fruit fly) 
NCBI Taxonomy ID
7227 
Chromosome Location
chr:2R;20062248-20073866;1
View in Ensembl genome browser  
Function in Stage
Function in Cell Type
Description
Temporarily unavailable 
The information of related literatures
1. T. Kauffman, J. Tran and S. DiNardo (2003) Mutations in Nop60B, the Drosophila homolog of human dyskeratosis congenita 1, affect the maintenance of the germ-line stem cell lineage during spermatogenesis. Dev Biol 253(2): 189-99. 

Abstract
Spermatogenesis in Drosophila is maintained by germ-line stem cells. These cells undergo self-renewing divisions and also generate daughter gonial cells, whose function is to amplify the germ cell pool. Gonial cells subsequently differentiate into spermatocytes that undergo meiosis and generate haploid gametes. To elucidate the circuitry that controls progression through spermatogenic stem cell lineages, we are identifying mutations that lead to either excess germ cells or germ cell loss. From a collection of male sterile mutants, we identified P-element-induced hypomorphic alleles of nop60B, a gene encoding a pseudouridine synthase. Although null mutations are lethal, our P element-induced alleles generate viable, but sterile flies, exhibiting severe testicular atrophy. Sterility is reversed by P-element excision, and the atrophy is rescued by a Nop60B transgene, confirming identity of the gene. Using cell-type-specific markers, we find that testicular atrophy is due to severe loss of germ cells, including stem cells, but much milder effects on the somatic cells, which are themselves maintained by a stem cell lineage. We show that Nop60B activity is required intrinsically for the maintenance of germ-line stem cells. The relationship of these phenotypes to the human syndrome Dyskeratosis congenita, caused by mutations in a Nop60B homolog, is discussed. PMID: [12645924] 

Back to Top
Figures for illustrating the function of this protein/gene
Function
Plays a central role in ribosomal RNA processing.Probable catalytic subunit of H/ACA small nucleolarribonucleoprotein (H/ACA snoRNP) complex, which catalyzespseudouridylation of rRNA. This involves the isomerization ofuridine such that the ribose is subsequently attached to C5,instead of the normal N1. Pseudouridine ('psi') residues may serveto stabilize the conformation of rRNAs. Required for maintenanceof the germline stem cell lineage during spermatogenesis. 
Back to Top
Subcellular Location
Nucleus, nucleolus. 
Tissue Specificity
 
Gene Ontology
GO IDGO termEvidence
GO:0005730 C:nucleolus IDA:FlyBase.
GO:0030529 C:ribonucleoprotein complex IEA:UniProtKB-KW.
GO:0009982 F:pseudouridine synthase activity IEA:InterPro.
GO:0003723 F:RNA binding IEA:UniProtKB-KW.
GO:0007281 P:germ cell development IMP:FlyBase.
GO:0022008 P:neurogenesis IMP:FlyBase.
GO:0001522 P:pseudouridine synthesis IMP:FlyBase.
GO:0006364 P:rRNA processing IMP:FlyBase.
GO:0035220 P:wing disc development IMP:FlyBase.
Back to Top
Interpro
IPR012960;    Dyskerin-like.
IPR002501;    PsdUridine_synth.
IPR020103;    PsdUridine_synth_cat_dom.
IPR002478;    PUA.
IPR015947;    PUA-like_domain.
IPR004802;    tRNA_PsdUridine_synth_B_fam.
Back to Top
Pfam
PF08068;    DKCLD;    1.
PF01472;    PUA;    1.
PF01509;    TruB_N;    1.
Back to Top
SMART
SM00359;    PUA;    1.
Back to Top
PROSITE
PS50890;    PUA;    1.
Back to Top
PRINTS
Created Date
18-Oct-2012 
Record Type
Experiment identified 
Protein sequence Annotation
CHAIN         1    508       H/ACA ribonucleoprotein complex subunit
                             4.
                             /FTId=PRO_0000121989.
DOMAIN      294    369       PUA.
COMPBIAS      8     16       Poly-Lys.
COMPBIAS    461    471       Poly-Lys.
COMPBIAS    489    499       Poly-Lys.
ACT_SITE    123    123       Nucleophile (By similarity).
MOD_RES     442    442       Phosphoserine.
MOD_RES     443    443       Phosphothreonine.
MOD_RES     444    444       Phosphoserine.
MOD_RES     445    445       Phosphoserine.
MOD_RES     449    449       Phosphothreonine.
MOD_RES     455    455       Phosphoserine.
MOD_RES     458    458       Phosphothreonine.
VAR_SEQ     212    253       GVFWVSCEAGSYIRTMCVHLGLVLGVGGQMLELRRVRSGIQ
                             S -> DLLIRSCNIWTITLIKEISSKIFLKIIECHRNLKSS
                             HDTLLR (in isoform C).
                             /FTId=VSP_036583.
VAR_SEQ     254    508       Missing (in isoform C).
                             /FTId=VSP_036584.
CONFLICT     69     69       P -> R (in Ref. 2; AAD19897).
Back to Top
Nucleotide Sequence
Length: 1765 bp   Go to nucleotide: FASTA
Protein Sequence
Length: 508 bp   Go to amino acid: FASTA
The verified Protein-Protein interaction information
UniProt
 Gene Symbol Ref Databases
Mst98CbDIP 
Mst98CaIntAct 
CG7025BioGRID 
Mst98CbBioGRID 
Mst98CaBioGRID 
CG7025MINT 
Other Protein-Protein interaction resources
String database  
View Microarray data
Temporarily unavailable 
Comments