Tag Content
SG ID
SG00000378 
UniProt Accession
Theoretical PI
5.45  
Molecular Weight
120649 Da  
Genbank Nucleotide ID
Genbank Protein ID
Gene Name
milt 
Gene Synonyms/Alias
ORFNames=CG43227 
Protein Name
Trafficking kinesin-binding protein milt 
Protein Synonyms/Alias
Protein milton 
Organism
Drosophila melanogaster (Fruit fly) 
NCBI Taxonomy ID
7227 
Chromosome Location
chr:2L;7037998-7056010;1
View in Ensembl genome browser  
Function in Stage
Function in Cell Type
Description
Temporarily unavailable 
The information of related literatures
1. A. C. Aldridge, L. P. Benson, M. M. Siegenthaler, B. T. Whigham, R. S. Stowers and K. G. Hales (2007) Roles for Drp1, a dynamin-related protein, and milton, a kinesin-associated protein, in mitochondrial segregation, unfurling and elongation during Drosophila spermatogenesis. Fly (Austin) 1(1): 38-46. 

Abstract
Mitochondria undergo dramatic rearrangement during Drosophila spermatogenesis. In wild type testes, the many small mitochondria present in pre-meiotic spermatocytes later aggregate, fuse, and interwrap in post-meiotic haploid spermatids to form the spherical Nebenkern, whose two giant mitochondrial compartments later unfurl and elongate beside the growing flagellar axoneme. Drp1 encodes a dynamin-related protein whose homologs in many organisms mediate mitochondrial fission and whose Drosophila homolog is known to govern mitochondrial morphology in neurons. The milton gene encodes an adaptor protein that links mitochondria with kinesin and that is required for mitochondrial transport in Drosophila neurons. To determine the roles of Drp1 and Milton in spermatogenesis, we used the FLP-FRT mitotic recombination system to generate spermatocytes homozygous for mutations in either gene in an otherwise heterozygous background. We found that absence of Drp1 leads to abnormal clustering of mitochondria in mature primary spermatocytes and aberrant unfurling of the mitochondrial derivatives in early Drp1 spermatids undergoing axonemal elongation. In milton spermatocytes, mitochondria are distributed normally; however, after meiosis, the Nebenkern is not strongly anchored to the nucleus, and the mitochondrial derivatives do not elongate properly. Our work defines specific functions for Drp1 and Milton in the anchoring, unfurling, and elongation of mitochondria during sperm formation. PMID: [18690063] 

Back to Top
Figures for illustrating the function of this protein/gene
Ref: A. C. Aldridge, L. P. Benson, M. M. Siegenthaler, B. T. Whigham, R. S. Stowers and K. G. Hales (2007) Roles for Drp1, a dynamin-related protein, and milton, a kinesin-associated protein, in mitochondrial segregation, unfurling and elongation during Drosophila spermatogenesis. Fly (Austin) 1(1): 38-46. PMID: [18690063]
Ref: A. C. Aldridge, L. P. Benson, M. M. Siegenthaler, B. T. Whigham, R. S. Stowers and K. G. Hales (2007) Roles for Drp1, a dynamin-related protein, and milton, a kinesin-associated protein, in mitochondrial segregation, unfurling and elongation during Drosophila spermatogenesis. Fly (Austin) 1(1): 38-46. PMID: [18690063]
Ref: A. C. Aldridge, L. P. Benson, M. M. Siegenthaler, B. T. Whigham, R. S. Stowers and K. G. Hales (2007) Roles for Drp1, a dynamin-related protein, and milton, a kinesin-associated protein, in mitochondrial segregation, unfurling and elongation during Drosophila spermatogenesis. Fly (Austin) 1(1): 38-46. PMID: [18690063]
Ref: A. C. Aldridge, L. P. Benson, M. M. Siegenthaler, B. T. Whigham, R. S. Stowers and K. G. Hales (2007) Roles for Drp1, a dynamin-related protein, and milton, a kinesin-associated protein, in mitochondrial segregation, unfurling and elongation during Drosophila spermatogenesis. Fly (Austin) 1(1): 38-46. PMID: [18690063]
Function
Required for kinesin-mediated axonal transport ofmitochondria to nerve terminals. The oocyte acquires the majorityof its mitochondria by competitive bidirectional transport alongmicrotubules mediated by the Milton adapter. Mitochondria enterthe young oocyte en mass from interconnected germ cells togenerate the large aggregate known as the Balbiani body. Milt andMiro form an essential protein complex that links Khc tomitochondria for light chain-independent, anterograde transport ofmitochondria. 
Back to Top
Subcellular Location
Mitochondrion. 
Tissue Specificity
Expressed primarily in axons and synapses. 
Gene Ontology
GO IDGO termEvidence
GO:0005739 C:mitochondrion IDA:UniProtKB.
GO:0003777 F:microtubule motor activity IMP:UniProtKB.
GO:0019896 P:axon transport of mitochondrion IDA:FlyBase.
GO:0051654 P:establishment of mitochondrion localization IMP:UniProtKB.
GO:0048311 P:mitochondrion distribution IMP:FlyBase.
GO:0007287 P:Nebenkern assembly IMP:FlyBase.
GO:0007310 P:oocyte dorsal/ventral axis specification IMP:UniProtKB.
GO:0030382 P:sperm mitochondrion organization IMP:FlyBase.
Back to Top
Interpro
IPR006933;    HAP1_N.
IPR022154;    Traffickng_kinesin-bd_prot_dom.
Back to Top
Pfam
PF04849;    HAP1_N;    1.
PF12448;    Milton;    1.
Back to Top
SMART
PROSITE
PRINTS
Created Date
18-Oct-2012 
Record Type
Experiment identified 
Protein sequence Annotation
CHAIN         1   1122       Trafficking kinesin-binding protein milt.
                             /FTId=PRO_0000351143.
DOMAIN       87    382       HAP1 N-terminal.
REGION        1    450       Sufficient for interaction with Khc.
COILED      142    209       Potential.
COILED      235    382       Potential.
COMPBIAS    854    872       Gln-rich.
MOD_RES     831    831       Phosphoserine.
MOD_RES     918    918       Phosphoserine.
VAR_SEQ       1    143       Missing (in isoform D).
                             /FTId=VSP_052934.
VAR_SEQ       1    135       MTHVNNGEVMEKEMEPTGERERDRETAAGSGVHHRFLASAS
                             ERDANSGNALEAAATKTKTGTTITNLEDLAFEACQNWSDLH
                             QDFFITDDELEYEDELSLGSSIGGNIATTTTADAAVEGLIT
                             GEHQNEQLLMEV -> MLSATLGANGGSQPLSPSAQATLSK
                             HLPRLQSKRLLQQTQLQSPAAARPQTCDASCLTELCSSENL
                             PEVEIFSLLEEQIPKYKVRNDFLTNFSGYANEDWFVPAPAL
                             PIPPEGLGLTKEQTRECLNYFL (in isoform A).
                             /FTId=VSP_052933.
CONFLICT   1098   1098       T -> P (in Ref. 1; AAK74155/AAK74156).
Back to Top
Nucleotide Sequence
Length: 5242 bp   Go to nucleotide: FASTA
Protein Sequence
Length: 1122 bp   Go to amino acid: FASTA
The verified Protein-Protein interaction information
Other Protein-Protein interaction resources
String database  
View Microarray data
Temporarily unavailable 
Comments