SpermatogenesisOnline 1.0
 

Tag Content
SG ID
SG00000402 
UniProt Accession
Theoretical PI
7.3  
Molecular Weight
48195 Da  
Genbank Nucleotide ID
Genbank Protein ID
Gene Name
ASB4 
Gene Synonyms/Alias
 
Protein Name
Ankyrin repeat and SOCS box protein 4 
Protein Synonyms/Alias
ASB-4 
Organism
Homo sapiens (Human) 
NCBI Taxonomy ID
9606 
Chromosome Location
chr:7;95107756-95169544;1
View in Ensembl genome browser  
Function in Stage
Function in Cell Type
Description
Members of the large family of Asb proteins are ubiquitously expressed in mammalian tissues.ASB-4 plays pivotal roles in mammalian testis development and spermatogenesis 
The information of related literatures
1. S. K. Kim, S. Y. Rhim, M. R. Lee, J. S. Kim, H. J. Kim, D. R. Lee and K. S. Kim (2008) Stage-specific expression of ankyrin and SOCS box protein-4 (Asb-4) during spermatogenesis. Mol Cells 25(2): 317-21. 

Abstract
Members of the large family of Asb proteins are ubiquitously expressed in mammalian tissues; however, the roles of individual Asb and their function in the developmental testes have not been reported. In this report, we isolated a murine Asb4 from mouse testis. Northern blot analysis revealed that mAsb-4 was expressed only in testes and produced in a stage-specific manner during spermatogenesis. It was expressed in murine testes beginning in the fourth week after birth and extending into adulthood. Pachytene spermatocytes had the highest level of expression. Interestingly, the human homologue of mAsb-4, ASB-4 (hASB-4) was also expressed in human testis. These results suggest that ASB-4 plays pivotal roles in mammalian testis development and spermatogenesis. PMID: [18414003] 

Back to Top
Figures for illustrating the function of this protein/gene
Function
Probable substrate-recognition component of a SCF-likeECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligasecomplex which mediates the ubiquitination and subsequentproteasomal degradation of target proteins. Promotesdifferentiation and maturation of the vascular lineage by anoxygen-dependent mechanism (By similarity). 
Back to Top
Subcellular Location
 
Tissue Specificity
 
Gene Ontology
GO IDGO termEvidence
GO:0031462 C:Cul2-RING ubiquitin ligase complex IDA:UniProtKB.
GO:0031466 C:Cul5-RING ubiquitin ligase complex IDA:UniProtKB.
GO:0004842 F:ubiquitin-protein ligase activity IEA:Compara.
GO:0035556 P:intracellular signal transduction IEA:InterPro.
GO:2001214 P:positive regulation of vasculogenesis ISS:UniProtKB.
GO:0051865 P:protein autoubiquitination IEA:Compara.
Back to Top
Interpro
IPR002110;    Ankyrin_rpt.
IPR020683;    Ankyrin_rpt-contain_dom.
IPR001496;    SOCS_C.
Back to Top
Pfam
PF00023;    Ank;    4.
PF07525;    SOCS_box;    1.
Back to Top
SMART
SM00248;    ANK;    6.
SM00969;    SOCS_box;    1.
Back to Top
PROSITE
PS50297;    ANK_REP_REGION;    1.
PS50088;    ANK_REPEAT;    5.
PS50225;    SOCS;    1.
Back to Top
PRINTS
Created Date
18-Oct-2012 
Record Type
Experiment identified 
Protein sequence Annotation
CHAIN         1    426       Ankyrin repeat and SOCS box protein 4.
                             /FTId=PRO_0000066928.
REPEAT       74    103       ANK 1.
REPEAT      106    135       ANK 2.
REPEAT      139    168       ANK 3.
REPEAT      174    203       ANK 4.
REPEAT      207    247       ANK 5.
REPEAT      251    280       ANK 6.
DOMAIN      371    423       SOCS box.
REGION      238    239       Essential for interaction with HIF1AN (By
                             similarity).
REGION      244    246       Essential for interaction with HIF1AN (By
                             similarity).
SITE        256    256       Essential for interaction with HIF1AN (By
                             similarity).
MOD_RES     246    246       (3S)-3-hydroxyasparagine; by HIF1AN (By
                             similarity).
VAR_SEQ     328    426       IQACHSCPKAIEVVVNAYEHIRWNTKWRRAIPDDDLEKYWD
                             FYHSLFTVCCNSPRTLMHLSRCAIRRTLHNRCHRAIPLLSL
                             PLSLKKYLLLEPEGIIY -> RLCPVVSRLRKIQMAALSEI
                             SK (in isoform 2).
                             /FTId=VSP_042668.
VARIANT      17     17       V -> L (in dbSNP:rs35047380).
                             /FTId=VAR_033512.
Back to Top
Nucleotide Sequence
Length: 1281 bp   Go to nucleotide: FASTA
Protein Sequence
Length: 426 bp   Go to amino acid: FASTA
The verified Protein-Protein interaction information
Other Protein-Protein interaction resources
String database  
View Microarray data
Temporarily unavailable 
Comments