CHAIN         1    595       Estrogen receptor.
                             /FTId=PRO_0000053618.
DNA_BIND    185    250       Nuclear receptor.
ZN_FING     185    205       NR C4-type.
ZN_FING     221    245       NR C4-type.
REGION        1    184       Modulating (transactivation AF-1);
                             mediates interaction with MACROD1.
REGION       35    174       Interaction with DDX5; self-association.
REGION       35     47       Required for interaction with NCOA1.
REGION      185    310       Mediates interaction with DNTTIP2.
REGION      251    310       Hinge.
REGION      262    595       Interaction with AKAP13.
REGION      264    595       Self-association.
REGION      311    595       Transactivation AF-2.
REGION      311    551       Steroid-binding.
MOD_RES       7      7       Phosphothreonine.
MOD_RES      10     10       Phosphoserine.
MOD_RES     104    104       Phosphoserine; by CDK2.
MOD_RES     106    106       Phosphoserine; by CDK2.
MOD_RES     118    118       Phosphoserine.
MOD_RES     167    167       Phosphoserine; by CK2.
MOD_RES     260    260       Asymmetric dimethylarginine; by PRMT1.
MOD_RES     537    537       Phosphotyrosine; by Tyr-kinases.
LIPID       447    447       S-palmitoyl cysteine (By similarity).
CARBOHYD     10     10       O-linked (GlcNAc) (By similarity).
VAR_SEQ       1    173       Missing (in isoform 3 and isoform 4).
                             /FTId=VSP_042460.
VAR_SEQ     255    366       Missing (in isoform 2).
                             /FTId=VSP_003680.
VAR_SEQ     458    595       VYTFLSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQ
                             QQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDL
                             LLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQ
                             KYYITGEAEGFPATV -> FTISHVEAKKRILNLHPKIFGN
                             KWFPRV (in isoform 4).
                             /FTId=VSP_042461.
VARIANT       6      6       H -> Y (in a breast cancer sample;
                             somatic mutation).
                             /FTId=VAR_033028.
VARIANT      77     77       G -> S (in dbSNP:rs9340773).
                             /FTId=VAR_018905.
VARIANT     160    160       G -> C.
                             /FTId=VAR_004671.
VARIANT     264    264       M -> I (in a breast cancer sample;
                             somatic mutation).
                             /FTId=VAR_033029.
VARIANT     364    364       V -> E (in estrogen resistance; dominant-
                             negative inhibitor of the wild-type ESR).
                             /FTId=VAR_004672.
VARIANT     400    400       G -> V (destabilizes the receptor and
                             decreases its affinity for estradiol at
                             25 degrees Celsius, but not at 4 degrees
                             Celsius).
                             /FTId=VAR_004673.
VARIANT     411    411       D -> RNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVC
                             LKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLDKITDTLIH
                             LMAKAGLTLQQQHQRLAQLLLILSHIRHM (in a 80
                             kDa form found in a breast cancer line;
                             contains an in-frame duplication of exons
                             6 and 7).
                             /FTId=VAR_010143.
MUTAGEN      39     39       L->P: Impairs AF-1 transactivation.
MUTAGEN      43     43       Y->P: Impairs AF-1 transactivation.
MUTAGEN     104    104       S->A: Loss of cyclin A-dependent
                             induction of transcriptional activation.
MUTAGEN     106    106       S->A: Loss of cyclin A-dependent
                             induction of transcriptional activation.
MUTAGEN     118    118       S->A: Decrease in phosphorylation,
                             abolishes AF-1 transactivation.
MUTAGEN     118    118       S->E: Enhances interaction with DDX5.
MUTAGEN     260    260       R->A,K: Loss of methylation.
MUTAGEN     386    386       I->C: Loss of transmembrane localization,
                             no effect on peripheral membrane
                             localization. Impairs activation of
                             estrogen-induced activation of NOS3 and
                             production of nitric oxide. No effect on
                             binding to ERES.
MUTAGEN     447    447       C->A: Loss of hormone binding capacity
                             and temperature-sensitive loss in DNA-
                             binding.
MUTAGEN     539    539       L->A: Abolishes interaction with NCOA1,
                             NCOA2 and NCOA3.
CONFLICT    452    452       I -> L (in Ref. 5; CAE45969).
TURN        186    188
STRAND      189    191
STRAND      194    196
STRAND      199    201
HELIX       203    213
STRAND      222    225
TURN        231    236
HELIX       238    248
HELIX       288    291
HELIX       293    304
HELIX       307    309
HELIX       312    321
STRAND      330    332
STRAND      333    335
HELIX       337    339
HELIX       342    363
HELIX       367    369
HELIX       372    395
STRAND      396    398
STRAND      401    405
STRAND      408    411
HELIX       412    415
STRAND      417    420
HELIX       421    438
HELIX       442    455
TURN        456    459
HELIX       466    492
HELIX       497    525
STRAND      528    530
STRAND      531    533
HELIX       536    544
TURN        546    548
Back to Top