| Tag | Content | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
SG ID |
SG00000478 |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
UniProt Accession |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Theoretical PI |
6.07
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecular Weight |
132494 Da
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genbank Nucleotide ID |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genbank Protein ID |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Name |
LEPR |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Synonyms/Alias |
DB, OBR |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Name |
Leptin receptor |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Synonyms/Alias |
LEP-R HuB219; OB receptor;OB-R CD_antigen=CD295;Flags: Precursor |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism |
Homo sapiens (Human) |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
NCBI Taxonomy ID |
9606 |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Chromosome Location |
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Function in Stage |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Function in Cell Type |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Description |
Leptin may have local effects on the function of testis and spermatogenesis. The dysfunction of spermatogenesis is associated with an increase in leptin and leptin receptor expression in the testis. |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
The information of related literatures |
1. B. Chen, J. H. Guo, Y. N. Lu, X. L. Ying, K. Hu, Z. Q. Xiang, Y. X. Wang, P. Chen and Y. R. Huang (2009) Leptin and varicocele-related spermatogenesis dysfunction. Int J Androl 32(5): 532-41. Abstract The objective of this study was to explore the relationships between varicocele-related spermatogenesis dysfunction and the expression of leptin and leptin receptors. In rats with experimental varicocele, the function of spermatogenesis, the expression of leptin and leptin receptors in testes were analysed; and in patients with varicocele-related male infertility, serum and seminal plasma levels of leptin, gonadal hormones and semen parameters were evaluated. In the testes of rats, leptin was expressed in seminiferous tubules and intersitium, leptin receptor was predominantly expressed in interstitium. The expression of leptin and its receptor in the testis of rats was not related to the weight of rat, but was inversely related to the weight of testis (r = -0.408, p = 0.009 and r = -0.433, p = 0.005, respectively), the Johnsen scores (r = -0.916, p = 0.000 and r = -0.863, p = 0.000, respectively), the seminiferous tubules diameter (r = -0.853, p = 0.000 and r = -0.870, p = 0.000, respectively) and the thickness of seminiferous epithelium (r = -0.929, p = 0.000 and r = -0.948, p = 0.000, respectively). In varicocele patients (N = 40), the sperm concentration and motility were significantly lower (p = 0.000) than those in the control group (N = 25), and the leptin level in seminal plasma was significantly higher (p = 0.000) than that in the control group. The leptin in serum and seminal plasma was positively related (r = 0.223, p = 0.002). The seminal plasma leptin level was inversely related to sperm concentration (r = -0.632, p = 0.000) and motility (r = -0.635, p = 0.000). There was no significant relation between serum leptin and seminal parameters and between leptin and gonadal hormone values. The dysfunction of spermatogenesis in varicocele-related infertile male is associated with increase in leptin and leptin receptors. Leptin may have local effects on the function of testis and spermatogenesis. PMID: [18484972] 2. T. Ishikawa, H. Fujioka, T. Ishimura, A. Takenaka and M. Fujisawa (2007) Expression of leptin and leptin receptor in the testis of fertile and infertile patients. Andrologia 39(1): 22-7. Abstract The aim of our study was to investigate the relationships between the expression of leptin, leptin receptor in the testis and spermatogenesis, and testosterone (T) concentration in infertile men. Testicular tissue samples were collected from the testes of five fertile volunteers, eight patients with obstructive azoospermia (OA), six patients with Sertoli cell-only syndrome (SCO) and 32 oligospermic patients with varicocele testis. In testicular tissue, leptin and leptin receptor were identified by staining with polyclonal antibodies. Serum follicle stimulating hormone, lutenising hormone (LH), and T were determined by chemiluminescence assays. Leptin was expressed on germ cells, mainly on spermatocytes. The ratio of immunostained germ cells to total germ cells was inversely correlated with the concentration of T (r = -0.32, P = 0.01), sperm concentration (r = -0.51, P = 0.002) and Johnsen's score (r = -0.44,P = 0.005). In contrast, leptin receptor immunostained cells were found in the interstitium, primarily in Leydig cells. Leptin receptor expression on Leydig cells was inversely correlated with serum T concentration (r = -0.50, P < 0.001). The dysfunction of spermatogenesis is associated with an increase in leptin and leptin receptor expression in the testis. PMID: [17212806] Back to Top |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Figures for illustrating the function of this protein/gene |
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Function |
Receptor for obesity factor (leptin). On ligand binding,mediates signaling through JAK2/STAT3. Involved in the regulationof fat metabolism and, in a hematopoietic pathway, required fornormal lymphopoiesis. May play a role in reproduction. Can alsomediate the ERK/FOS signaling pathway (By similarity). Back to Top |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Subcellular Location |
Isoform E: Secreted (Probable). |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Tissue Specificity |
Isoform A is expressed in fetal liver and inhematopoietic tissues and choroid plexus. In adults highestexpression in heart, liver, small intestine, prostate and ovary.Low level in lung and kidney. Isoform B is highly expressed inhypothalamus. |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene Ontology |
|
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Interpro |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Pfam |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
SMART |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PROSITE |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PRINTS |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Created Date |
18-Oct-2012 |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Record Type |
Experiment identified |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein sequence Annotation |
SIGNAL 1 21 CHAIN 22 1165 Leptin receptor. /FTId=PRO_0000010904. TOPO_DOM 22 839 Extracellular (Potential). TRANSMEM 840 862 Helical; (Potential). TOPO_DOM 863 1165 Cytoplasmic (Potential). DOMAIN 237 330 Fibronectin type-III 1. DOMAIN 331 429 Ig-like. DOMAIN 537 631 Fibronectin type-III 2. DOMAIN 639 732 Fibronectin type-III 3. DOMAIN 734 829 Fibronectin type-III 4. REGION 467 484 Leptin-binding (Probable). REGION 893 898 Required for JAK2 activation (By similarity). MOTIF 622 626 WSXWS motif. MOTIF 871 879 Box 1 motif. MOD_RES 986 986 Phosphotyrosine; by JAK2 (By similarity). MOD_RES 1141 1141 Phosphotyrosine; by JAK2 (By similarity). CARBOHYD 23 23 N-linked (GlcNAc...). CARBOHYD 41 41 N-linked (GlcNAc...). CARBOHYD 56 56 N-linked (GlcNAc...). CARBOHYD 73 73 N-linked (GlcNAc...). CARBOHYD 81 81 N-linked (GlcNAc...). CARBOHYD 98 98 N-linked (GlcNAc...). CARBOHYD 187 187 N-linked (GlcNAc...). CARBOHYD 206 206 N-linked (GlcNAc...). CARBOHYD 276 276 N-linked (GlcNAc...). CARBOHYD 347 347 N-linked (GlcNAc...). CARBOHYD 397 397 N-linked (GlcNAc...). CARBOHYD 516 516 N-linked (GlcNAc...). CARBOHYD 624 624 N-linked (GlcNAc...). CARBOHYD 659 659 N-linked (GlcNAc...). CARBOHYD 688 688 N-linked (GlcNAc...). CARBOHYD 697 697 N-linked (GlcNAc...). CARBOHYD 728 728 N-linked (GlcNAc...). CARBOHYD 750 750 N-linked (GlcNAc...). DISULFID 37 90 DISULFID 89 99 DISULFID 131 142 DISULFID 186 196 DISULFID 188 193 DISULFID 352 412 DISULFID 413 418 DISULFID 436 447 DISULFID 473 528 DISULFID 488 498 VAR_SEQ 840 1165 Missing (in isoform E). /FTId=VSP_001688. VAR_SEQ 892 958 PETFEHLFIKHTASVTCGPLLLEPETISEDISVDTSWKNKD EMMPTTVVSLLSTTDLEKGSVCISDQ -> MLEGSMFVKSH HHSLISSTQGHKHCGRPQGPLHRKTRDLCSLVYLLTLPPLL SYDPAKSPSVRNTQE (in isoform C). /FTId=VSP_001691. VAR_SEQ 892 906 PETFEHLFIKHTASV -> KMPGTKELLGGGWLT (in isoform D). /FTId=VSP_001693. VAR_SEQ 892 896 PETFE -> RTDIL (in isoform A). /FTId=VSP_001689. VAR_SEQ 897 1165 Missing (in isoform A). /FTId=VSP_001690. VAR_SEQ 907 1165 Missing (in isoform D). /FTId=VSP_001694. VAR_SEQ 959 1165 Missing (in isoform C). /FTId=VSP_001692. VARIANT 109 109 K -> R (in dbSNP:rs1137100). /FTId=VAR_002703. VARIANT 124 124 D -> G (in dbSNP:rs35573508). /FTId=VAR_049167. VARIANT 204 204 K -> R. /FTId=VAR_002704. VARIANT 223 223 Q -> R (in dbSNP:rs1137101). /FTId=VAR_002705. VARIANT 503 503 I -> V (in dbSNP:rs13306526). /FTId=VAR_028201. VARIANT 656 656 K -> N (in dbSNP:rs8179183). /FTId=VAR_002706. VARIANT 675 675 S -> T. /FTId=VAR_002707. VARIANT 699 699 T -> M (in dbSNP:rs34499590). /FTId=VAR_049168. MUTAGEN 986 986 Y->F: Greatly reduced PTPN11 binding; no PTPN11 phosphorylation; no effect on STAT3 phosphorylation. MUTAGEN 1078 1079 YY->FF: No effect on PTPN11 nor STAT3 phosphorylation. MUTAGEN 1141 1141 Y->F: No effect on PTPN11 phosphorylation; no STAT3 phosphorylation. CONFLICT 85 85 T -> A (in Ref. 3; AAC50509/AAC50510/ AAC50511). CONFLICT 976 976 D -> A (in Ref. 1; AAA93015 and 4; AAB09673). STRAND 435 438 STRAND 445 449 STRAND 461 468 STRAND 484 486 STRAND 488 490 STRAND 496 500 STRAND 509 516 STRAND 527 529 HELIX 531 534 STRAND 544 548 TURN 549 552 STRAND 553 557 STRAND 568 580 STRAND 584 588 STRAND 595 598 STRAND 607 615 Back to Top |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Nucleotide Sequence |
Length: 3800 bp Go to nucleotide: FASTA |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein Sequence |
Length: 1165 bp Go to amino acid: FASTA |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
The verified Protein-Protein interaction information |
| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other Protein-Protein interaction resources |
String database |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
View Microarray data |
Temporarily unavailable |
|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Comments |
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
