Tag Content
SG ID
SG00000618 
UniProt Accession
Theoretical PI
6.68  
Molecular Weight
45107 Da  
Genbank Nucleotide ID
Genbank Protein ID
Gene Name
HSFY2 
Gene Synonyms/Alias
HSF2L, HSFY 
Protein Name
Heat shock transcription factor, Y-linked 
Protein Synonyms/Alias
Heat shock transcription factor 2-like protein;HSF2-like 
Organism
Homo sapiens (Human) 
NCBI Taxonomy ID
9606 
Chromosome Location
chr:Y;20708557-20750849;1
View in Ensembl genome browser  
Function in Stage
Function in Cell Type
Description
The study has confirmed that the detection of microdeletions of AZF region is significant from the diagnostic and prognostic. 
The information of related literatures
1. R. Behulova, L. Strhakova, I. Boronova, A. Cibulkova, M. Konecny, L. Danisovic and V. Repiska (2011) DNA analysis of Y chromosomal AZF region in Slovak population with fertility disorders. Bratisl Lek Listy 112(4): 183-7. 

Abstract
BACKGROUND PMID: [21585124] 

2. A. Tessari, E. Salata, A. Ferlin, L. Bartoloni, M. L. Slongo and C. Foresta (2004) Characterization of HSFY, a novel AZFb gene on the Y chromosome with a possible role in human spermatogenesis. Mol Hum Reprod 10(4): 253-8. 

Abstract
HSFY (heat shock transcription factor, Y chromosome) has been mapped in the AZFb region of the Y chromosome, whose deletion results in severe male infertility. HSFY belongs to the heat shock factor family that has been shown to be implicated in spermatogenesis both in animals and humans. We report the characterization of the genomic structure, the number of copies on the Y chromosome and the expression of the gene. By comparison of data obtained from expression analysis and from GenBank cDNA sequences, seven exons were identified. Alternative splicing generates three different transcripts and proteins, each containing an HSF domain typical of HSF proteins. Two identical and functional full-length copies of HSFY map in palindrome P4 of AZFb, whereas four similar sequences mapping in two clusters in palindrome P1 of AZFc and P3 seem to represent pseudogenes. Sequences similar to few HSFY exons are also located in the short arm of chromosomes Y, X and 22. Expression analysis revealed that the three HSFY transcripts are differentially expressed, transcript 1 being present in many tissues including testis and ejaculated sperm, and transcripts 2 and 3 being testis-specific. These data suggest that HSFY could have an important role in human spermatogenesis. PMID: [14985478] 

3. Y. Sato, K. Yoshida, T. Shinka, S. Nozawa, Y. Nakahori and T. Iwamoto (2006) Altered expression pattern of heat shock transcription factor, Y chromosome (HSFY) may be related to altered differentiation of spermatogenic cells in testes with deteriorated spermatogenesis. Fertil Steril 86(3): 612-8. 

Abstract
OBJECTIVE PMID: [16952509] 

4. T. Shinka, Y. Sato, G. Chen, T. Naroda, K. Kinoshita, Y. Unemi, K. Tsuji, K. Toida, T. Iwamoto and Y. Nakahori (2004) Molecular characterization of heat shock-like factor encoded on the human Y chromosome, and implications for male infertility. Biol Reprod 71(1): 297-306. 

Abstract
Azoospermia and oligospermia are major causes of male infertility. Some genes located on the Y chromosome are suggested as candidates. Recently, HSFY, which is similar to the HSF (heat shock transcription factor) family, has been mapped on the human Y chromosome as multicopies. However, newly available sequence data deposited at NCBI shows that only the HSFY gene located on Yq has a long open reading frame containing a HSF-type DNA-binding domain. HSFY is similar to LW-1 on the human X chromosome and a murine HSFY-like sequence (mHSFYL), 4933413G11Rik, on the mouse chromosome 1. LW-1 and mHSFYL have 53% and 70% homology to HSFY for amino acid sequences of their presumed DNA-binding domains, respectively. Comparison of the presumed DNA-binding domains unveiled that the three HSF-like factors, HSFY, LW-1, and mHSFYL, belong to a different class than conventional HSFs. When we screened for deletions on the Yq of males suffering from infertility, we found that HSFY was involved in interstitial deletions on the Y chromosomes for two azoospermic males who had DBY, USP9Y, and DAZ but did not have RBMY located on the AZFb. Expression analysis of HSFY, LW-1, and mHSFYL unveiled that they are expressed predominantly in testis. Furthermore, immunhistochemistry of HSFY in testis showed that its expression is restricted to both Sertoli cells and spermatogenic cells and that it exhibits a stage-dependent translocation from the cytoplasm to the nucleus in spermatogenetic cells during spermatogenesis. These results may suggest that deletion of HSFY is involved in azoospermia or oligospermia. PMID: [15044259] 

Back to Top
Figures for illustrating the function of this protein/gene
Function
 
Back to Top
Subcellular Location
Nucleus. Cytoplasm. 
Tissue Specificity
Testis-specific. Present in Sertoli cells andspermatogenic cells (at protein level). 
Gene Ontology
GO IDGO termEvidence
GO:0005737 C:cytoplasm IEA:UniProtKB-SubCell.
GO:0005634 C:nucleus IEA:UniProtKB-SubCell.
GO:0043565 F:sequence-specific DNA binding IEA:InterPro.
GO:0003700 F:sequence-specific DNA binding transcription factor activity IEA:InterPro.
GO:0006351 P:transcription, DNA-dependent IEA:UniProtKB-KW.
Back to Top
Interpro
IPR000232;    HSF_DNA-bd.
IPR011991;    WHTH_trsnscrt_rep_DNA-bd.
Back to Top
Pfam
PF00447;    HSF_DNA-bind;    1.
Back to Top
SMART
SM00415;    HSF;    1.
Back to Top
PROSITE
PS00434;    HSF_DOMAIN;    FALSE_NEG.
Back to Top
PRINTS
Created Date
18-Oct-2012 
Record Type
Experiment identified 
Protein sequence Annotation
CHAIN         1    401       Heat shock transcription factor, Y-
                             linked.
                             /FTId=PRO_0000124573.
DNA_BIND     76    194       By similarity.
VAR_SEQ     172    203       LKFYYNPNFKRGYPQLLVRVKRRIGVKNASPI -> IRFTK
                             MKLSRSSTYENRYLCCNLHLKDESNYS (in isoform
                             2).
                             /FTId=VSP_009179.
VAR_SEQ     173    214       KFYYNPNFKRGYPQLLVRVKRRIGVKNASPISTLFNEDFNK
                             K -> HVFVFHHSLFGATFGEHHFQPCPLPSGNKAPISTWS
                             GDSWLL (in isoform 3).
                             /FTId=VSP_009180.
VAR_SEQ     204    401       Missing (in isoform 2).
                             /FTId=VSP_009181.
VAR_SEQ     215    401       Missing (in isoform 3).
                             /FTId=VSP_009182.
CONFLICT     94     99       KSISWD -> SLFSWE (in Ref. 2; AAK13479).
CONFLICT    164    164       K -> I (in Ref. 2; AAK13479).
Back to Top
Nucleotide Sequence
Length: 1476 bp   Go to nucleotide: FASTA
Protein Sequence
Length: 401 bp   Go to amino acid: FASTA
The verified Protein-Protein interaction information
UniProt
Gene Symbol Ref Databases
Other Protein-Protein interaction resources
String database  
View Microarray data
Temporarily unavailable 
Comments