SIGNAL 1 23
CHAIN 24 1255 Mucin-1.
/FTId=PRO_0000019277.
CHAIN 24 1097 Mucin-1 subunit alpha.
/FTId=PRO_0000317446.
CHAIN 1098 1255 Mucin-1 subunit beta.
/FTId=PRO_0000317447.
TOPO_DOM 24 1158 Extracellular (Potential).
TRANSMEM 1159 1181 Helical; (Potential).
TOPO_DOM 1182 1255 Cytoplasmic (Potential).
REPEAT 61 80 1; approximate.
REPEAT 81 100 2; approximate.
REPEAT 101 120 3.
REPEAT 121 140 4.
REPEAT 141 160 5.
REPEAT 161 180 6.
REPEAT 181 200 7.
REPEAT 201 220 8.
REPEAT 221 240 9.
REPEAT 241 260 10.
REPEAT 261 280 11.
REPEAT 281 300 12.
REPEAT 301 320 13.
REPEAT 321 340 14.
REPEAT 341 360 15.
REPEAT 361 380 16.
REPEAT 381 400 17.
REPEAT 401 420 18.
REPEAT 421 440 19.
REPEAT 441 460 20.
REPEAT 461 480 21.
REPEAT 481 500 22.
REPEAT 501 520 23.
REPEAT 521 540 24.
REPEAT 541 560 25.
REPEAT 561 580 26.
REPEAT 581 600 27.
REPEAT 601 620 28.
REPEAT 621 640 29.
REPEAT 641 660 30.
REPEAT 661 680 31.
REPEAT 681 700 32.
REPEAT 701 720 33.
REPEAT 721 740 34.
REPEAT 741 760 35.
REPEAT 761 780 36.
REPEAT 781 800 37.
REPEAT 801 820 38.
REPEAT 821 840 39.
REPEAT 841 860 40.
REPEAT 861 880 41.
REPEAT 881 900 42.
REPEAT 901 920 43.
REPEAT 921 940 44.
REPEAT 941 960 45.
REPEAT 961 980 46; approximate.
REPEAT 981 1000 47; approximate.
REPEAT 1001 1020 48; approximate.
DOMAIN 1034 1151 SEA.
REGION 126 965 42 X 20 AA approximate tandem repeats of
P-A-P-G-S-T-A-P-P-A-H-G-V-T-S-A-P-D-T-R.
REGION 1192 1228 Interaction with P53.
REGION 1223 1230 Required for interaction with GSK3B.
REGION 1233 1241 Required for interaction with beta- and
gamma-catenins.
MOTIF 1203 1206 Interaction with GRB2.
MOTIF 1229 1232 Interaction with SRC and ESR1.
MOTIF 1243 1246 Required for interaction with AP1S2.
SITE 1097 1098 Cleavage; by autolysis.
MOD_RES 1191 1191 Phosphotyrosine.
MOD_RES 1203 1203 Phosphotyrosine; by PDGFR.
MOD_RES 1209 1209 Phosphotyrosine.
MOD_RES 1212 1212 Phosphotyrosine.
MOD_RES 1218 1218 Phosphotyrosine; by PDGFR.
MOD_RES 1224 1224 Phosphothreonine; by PKC/PRKCD.
MOD_RES 1227 1227 Phosphoserine; by GSK3-beta.
MOD_RES 1229 1229 Phosphotyrosine; by CSK, EGFR and SRC.
MOD_RES 1243 1243 Phosphotyrosine.
LIPID 1184 1184 S-palmitoyl cysteine.
LIPID 1186 1186 S-palmitoyl cysteine.
CARBOHYD 131 131 O-linked (GalNAc...) (Probable).
CARBOHYD 139 139 O-linked (GalNAc...) (Probable).
CARBOHYD 140 140 O-linked (GalNAc...) (Potential).
CARBOHYD 144 144 O-linked (GalNAc...) (Potential).
CARBOHYD 957 957 N-linked (GlcNAc...) (Potential).
CARBOHYD 975 975 N-linked (GlcNAc...) (Potential).
CARBOHYD 1029 1029 N-linked (GlcNAc...) (Potential).
CARBOHYD 1055 1055 N-linked (GlcNAc...) (Potential).
CARBOHYD 1133 1133 N-linked (GlcNAc...) (Potential).
VAR_SEQ 19 21 Missing (in isoform 3).
/FTId=VSP_003281.
VAR_SEQ 19 19 T -> TATTAPKPAT (in isoform 2).
/FTId=VSP_003280.
VAR_SEQ 20 31 Missing (in isoform 4).
/FTId=VSP_003282.
VAR_SEQ 54 1053 Missing (in isoform 7).
/FTId=VSP_003285.
VAR_SEQ 54 1035 Missing (in isoform 8 and isoform 9).
/FTId=VSP_003286.
VAR_SEQ 54 87 VSMTSSVLSSHSPGSGSSTTQGQDVTLAPATEPA -> IPA
PTTTKSCRETFLKCFCRFINKGVFWASPILS (in
isoform 10).
/FTId=VSP_035046.
VAR_SEQ 54 70 VSMTSSVLSSHSPGSGS -> IPAPTTTKSCRETFLKW
(in isoform 6).
/FTId=VSP_003283.
VAR_SEQ 71 1095 Missing (in isoform 6).
/FTId=VSP_003284.
VAR_SEQ 88 1139 Missing (in isoform 10).
/FTId=VSP_035047.
VAR_SEQ 1077 1181 Missing (in isoform 9).
/FTId=VSP_003287.
VAR_SEQ 1077 1087 FLQIYKQGGFL -> VSIGLSFPMLP (in isoform
5).
/FTId=VSP_003288.
VAR_SEQ 1088 1255 Missing (in isoform 5).
/FTId=VSP_003289.
VARIANT 1117 1117 V -> M (in dbSNP:rs1611770).
/FTId=VAR_019390.
VARIANT 1142 1142 S -> N (in dbSNP:rs11465207).
/FTId=VAR_019391.
MUTAGEN 1098 1098 S->A,D,E,F,G,H,I,K,L,M,N,P,Q,R,V,W,Y:
Completely abrogates cleavage.
MUTAGEN 1098 1098 S->C,T: Almost complete cleavage.
MUTAGEN 1116 1116 D->A: Greatly reduced formation of
isoform 5/isoform 7 complex.
MUTAGEN 1116 1116 D->E: No effect on formation of isoform
5/isoform 7 complex.
MUTAGEN 1184 1184 C->A: S-palmitoylation reduced by 50%.
Complete loss of palmitoylation, no
effect on endocytosis, recycling
inhibited and AP1S1 binding reduced by
30%; when associated with C-1186.
Accumulates in intracellular
compartments; when associated with C-1186
and N-1203.
MUTAGEN 1186 1186 C->A: S-palmitoylation reduced by 50%.
Complete loss of palmitoylation, no
effect on endocytosis, recycling
inhibited, and AP1S1 binding reduced by
30%; when associated with C-1184.
Accumulates in intracellular
compartments; when associated with C-1184
and N-1203.
MUTAGEN 1187 1189 RRK->AAA: No nuclear targeting of HRG-
stimulated MUC1 C-terminal nor JUP/gamma-
catenin. No effect on interaction with
JUP/gamma-catenin.
MUTAGEN 1187 1189 RRK->QQQ: No effect on palmitoylation.
MUTAGEN 1191 1191 Y->F: No effect on EGFR-mediated
phosphorylation.
MUTAGEN 1191 1191 Y->N: No effect on endocytosis.
MUTAGEN 1203 1203 Y->E: No effect on nuclear colocalization
of MUC1CT and CTNNB1. No effect on in
vitro PDFGR-induced cell invasiveness.
MUTAGEN 1203 1203 Y->F: No effect on EGFR-mediated
phosphorylation. No nuclear localization
of MUC1CT. Reduced in vitro PDGFR-induced
cell invasiveness.
MUTAGEN 1203 1203 Y->N: Reduced endocytosis by 30%. Greatly
reduced binding to AP1S2 and GRB2.
Binding AP1S1 reduced by 25%. Reduced
endocytosis by 77%; when associated with
N-1243. Accumulates in intracellular
compartments; when associated with C-1184
and C-1186.
MUTAGEN 1209 1209 Y->F: Some reduction in EGFR-mediated
phosphorylation.
MUTAGEN 1218 1218 Y->F: No effect on EGFR-mediated
phosphorylation. No nuclear
colocalization of MUC1CT and CTNNB1.
MUTAGEN 1223 1223 S->A: No change in PRKCD- nor GSK3B-
mediated phosphorylation.
MUTAGEN 1224 1224 T->A: Loss of PRKCD-mediated
phosphorylation. Decreased PRKCD binding.
No increased binding to CTNNB1 in the
presence of autophosphorylated PRKCD.
Increases formation of E-cadherin/beta-
catenin complex.
MUTAGEN 1227 1227 S->A: No change in PRKCD-mediated
phosphorylation. Loss of GSK3B-mediated
phosphorylation. CTNNB1.
MUTAGEN 1229 1229 Y->F: Greatly reduced EGFR- and Src-
mediated phosphorylation. No nuclear
localization of MUC1CT. Reduced in vitro
PDGFR-mediated phosphorylation. Decreased
Src-binding.
MUTAGEN 1229 1229 Y->N: No effect on endocytosis.
MUTAGEN 1243 1243 Y->N: Reduces binding to AP1S2 by 33%.
Greatly reduced binding to GRB2. Reduced
endocytosis by 50%. Reduced endocytosis
by 77%; when associated with N-1203.
CONFLICT 2 2 T -> A (in Ref. 20; AAD14369).
CONFLICT 134 134 P -> Q (in Ref. 18; AAA35757).
CONFLICT 154 154 P -> Q (in Ref. 18).
CONFLICT 1021 1021 S -> T (in Ref. 2 and 3).
CONFLICT 1193 1193 Q -> L (in Ref. 11; AAK30142).
CONFLICT 1231 1231 K -> T (in Ref. 9; AAD10858).
CONFLICT 1251 1251 T -> A (in Ref. 1; AAA60019).
STRAND 1042 1052
HELIX 1056 1059
HELIX 1064 1080
TURN 1082 1085
STRAND 1086 1096
STRAND 1099 1107
TURN 1109 1111
HELIX 1114 1132
STRAND 1136 1142
Back to Top