SpermatogenesisOnline 1.0
 

Tag Content
SG ID
SG00001976 
UniProt Accession
Theoretical PI
6.91  
Molecular Weight
95440 Da  
Genbank Nucleotide ID
Genbank Protein ID
Gene Name
Odf2 
Gene Synonyms/Alias
Odf84 
Protein Name
Outer dense fiber protein 2 
Protein Synonyms/Alias
84 kDa outer dense fiber protein; Cenexin; Outer dense fiber of sperm tails protein 2; 
Organism
Rattus norvegicus (Rat) 
NCBI Taxonomy ID
10116 
Chromosome Location
chr:3;8876938-8921175;1
View in Ensembl genome browser  
Function in Stage
Function in Cell Type
Description
Temporarily unavailable 
The information of related literatures
1. E. Rivkin, L. L. Tres and A. L. Kierszenbaum (2008) Genomic origin, processing and developmental expression of testicular outer dense fiber 2 (ODF2) transcripts and a novel nucleolar localization of ODF2 protein. Mol Reprod Dev 75(11): 1591-606. 

Abstract
Outer dense fibers are a major constituent of the sperm tail and outer dense fiber 2 (ODF2) protein is one of their major components. ODF2 shares partial homology with cenexin 1 and cenexin 2, regarded as centriolar proteins. We show that ODF2 and cenexin 2 transcripts are the product of differential splicing of a single gene, designated Cenexin/ODF2 and that cenexin 1 is an incomplete clone of ODF2. ODF2 terminates in exon 20b whereas in cenexin 2 this exon is spliced out and translation terminates in exon 24. We demonstrate a transcriptional switch during rat testicular development, from somatic-type to testis-type ODF2 and cenexin transcripts during the onset of meiosis. The switch is completed when spermiogenesis is established. ODF2 immunoreactive sites were visualized in the acroplaxome, along the sperm tail and the centrosome-derived sperm head-to-tail coupling apparatus. An unexpected finding was the presence of ODF2 antigenic sites, but not cenexin antigenic sites, in the dense fibrillar component of the nucleolus of Sertoli cells, spermatogonia and primary spermatocytes. The characterization of the genomic origin, processing and developmental expression of ODF2 transcript isoforms and their protein products can help reconcile differences in the literature on the role of ODF2 and cenexin in the centrosome. Furthermore, the finding of ODF2 in the dense fibrillar component of the nucleolus suggests that this protein, in addition to its presence in sperm outer dense fibers and centrosome, highlights and adds to the nucleolar function during spermatogenesis and early embryogenesis. PMID: [18398819] 

Back to Top
Figures for illustrating the function of this protein/gene
Ref: E. Rivkin, L. L. Tres and A. L. Kierszenbaum (2008) Genomic origin, processing and developmental expression of testicular outer dense fiber 2 (ODF2) transcripts and a novel nucleolar localization of ODF2 protein. Mol Reprod Dev 75(11): 1591-606. PMID: [18398819]
Ref: E. Rivkin, L. L. Tres and A. L. Kierszenbaum (2008) Genomic origin, processing and developmental expression of testicular outer dense fiber 2 (ODF2) transcripts and a novel nucleolar localization of ODF2 protein. Mol Reprod Dev 75(11): 1591-606. PMID: [18398819]
Ref: E. Rivkin, L. L. Tres and A. L. Kierszenbaum (2008) Genomic origin, processing and developmental expression of testicular outer dense fiber 2 (ODF2) transcripts and a novel nucleolar localization of ODF2 protein. Mol Reprod Dev 75(11): 1591-606. PMID: [18398819]
Ref: E. Rivkin, L. L. Tres and A. L. Kierszenbaum (2008) Genomic origin, processing and developmental expression of testicular outer dense fiber 2 (ODF2) transcripts and a novel nucleolar localization of ODF2 protein. Mol Reprod Dev 75(11): 1591-606. PMID: [18398819]
Function
Seems to be a major component of sperm tail outer densefibers (ODF). ODFs are filamentous structures located on theoutside of the axoneme in the midpiece and principal piece of themammalian sperm tail and may help to maintain the passive elasticstructures and elastic recoil of the sperm tail. May have amodulating influence on sperm motility. Functions as a generalscaffold protein that is specifically localized at thedistal/subdistal appendages of mother centrioles. Component of thecentrosome matrix required for the localization of PLK1 and NIN tothe centrosomes. Required for the formation and/or maintenance ofnormal CETN1 assembly. 
Back to Top
Subcellular Location
Cytoplasm, cytoskeleton, centrosome. Cellprojection, cilium. Cytoplasm, cytoskeleton, centrosome,centriole. Cytoplasm, cytoskeleton, spindle pole. Note=Localizedat the microtubule organizing centers in interphase and spindlepoles in mitosis. Localized at the distal/subdistal appendages ofmother centrioles. 
Tissue Specificity
Testis-specific. Expressed in the proximalcompartment of the elongated spermatid tail; later expressionprogresses to the distal spermatid tail compartment located in thelumen of the seminiferous epithelium. In spermatids (stages II-III) expression of the tails peaks and remains strong during theremaining steps of spermiogenesis (at protein level). Expressioncorrelates with the onset of spermatogenesis and is first detectedat 30 days. Higher expression is seen in testis of 40-day-old andadults that are older than 50 days. No expression is seen in 10-and 20-day-old testes. 
Gene Ontology
GO IDGO termEvidence
GO:0005814 C:centriole IEA:UniProtKB-SubCell.
GO:0005929 C:cilium IEA:UniProtKB-SubCell.
GO:0005874 C:microtubule IEA:UniProtKB-KW.
GO:0001520 C:outer dense fiber IDA:RGD.
GO:0000922 C:spindle pole IEA:UniProtKB-SubCell.
GO:0007275 P:multicellular organismal development IEA:UniProtKB-KW.
GO:0007286 P:spermatid development IEP:RGD.
Back to Top
Interpro
IPR026099;    Odf2-rel.
Back to Top
Pfam
SMART
PROSITE
PRINTS
Created Date
18-Oct-2012 
Record Type
Experiment identified 
Protein sequence Annotation
CHAIN         1    825       Outer dense fiber protein 2.
                             /FTId=PRO_0000299460.
COILED      139    212       Potential.
COILED      240    418       Potential.
COILED      456    793       Potential.
VAR_SEQ       1     42       Missing (in isoform 4 and isoform 5).
                             /FTId=VSP_027677.
VAR_SEQ       1     36       MKDRSSTPPLHVHVDENTPVHVHIKKLPKPSAASSQ -> M
                             SASSSGGSPRFPSCGKNGVTSLTQKKVLRTPCGAPSVTVT
                             (in isoform 3).
                             /FTId=VSP_027678.
VAR_SEQ      60     78       Missing (in isoform 3, isoform 4 and
                             isoform 5).
                             /FTId=VSP_027679.
VAR_SEQ     276    276       E -> ELCLKVPECARQHRPGRERQEDCQ (in isoform
                             5).
                             /FTId=VSP_027680.
VAR_SEQ     630    652       RSRIEHQGDKLELAREKHQASQK -> HSRVRDWQKGSHEL
                             ARAGARLPR (in isoform 5).
                             /FTId=VSP_027681.
VAR_SEQ     633    652       IEHQGDKLELAREKHQASQK -> VRDWQKGSHELARAGAR
                             LPR (in isoform 3 and isoform 4).
                             /FTId=VSP_027682.
VAR_SEQ     653    825       Missing (in isoform 3, isoform 4 and
                             isoform 5).
                             /FTId=VSP_027683.
VAR_SEQ     763    769       VDRRYQS -> ENQKCWK (in isoform 2).
                             /FTId=VSP_027684.
VAR_SEQ     770    825       Missing (in isoform 2).
                             /FTId=VSP_027685.
CONFLICT     46     46       D -> Y (in Ref. 2; AAC53134).
CONFLICT    107    108       DD -> EE (in Ref. 1; CAA64567).
CONFLICT    120    120       K -> E (in Ref. 2; AAC53134).
CONFLICT    483    483       D -> H (in Ref. 2; AAC53134).
CONFLICT    511    511       A -> P (in Ref. 3; AAC08408).
CONFLICT    543    543       S -> T (in Ref. 1; CAA64567).
Back to Top
Nucleotide Sequence
Length: 2203 bp   Go to nucleotide: FASTA
Protein Sequence
Length: 825 bp   Go to amino acid: FASTA
The verified Protein-Protein interaction information
UniProt
 Gene Symbol Ref Databases
Other Protein-Protein interaction resources
String database  
View Microarray data
Temporarily unavailable 
Comments