SpermatogenesisOnline 1.0

Tag Content
SG ID
SG00005132 
UniProt Accession
Theoretical PI
7.04  
Molecular Weight
82409 Da  
Genbank Nucleotide ID
Genbank Protein ID
Gene Name
Zc3h14 
Gene Synonyms/Alias
 
Protein Name
Zinc finger CCCH domain-containing protein 14 
Protein Synonyms/Alias
 
Organism
Mus musculus (Mouse) 
NCBI Taxonomy ID
10090 
Chromosome Location
chr:12;99985178-100025984;1
View in Ensembl genome browser  
Function in Stage
Uncertain 
Function in Cell Type
Uncertain 
Probability (GAS) of Function in Spermatogenesis
0.597237355 
The probability was calculated by GAS algorithm, ranging from 0 to 1. The closer it is to 1, the more possibly it functions in spermatogenesis.
Description
Temporarily unavailable 
Abstract of related literatures
1. This study describes comprehensive polling of transcription start and termination sites and analysis of previously unidentified full-length complementary DNAs derived from the mouse genome. We identify the 5' and 3' boundaries of 181,047 transcripts with extensive variation in transcripts arising from alternative promoter usage, splicing, and polyadenylation. There are 16,247 new mouse protein-coding transcripts, including 5154 encoding previously unidentified proteins. Genomic mapping of the transcriptome reveals transcriptional forests, with overlapping transcription on both strands, separated by deserts in which few transcripts are observed. The data provide a comprehensive platform for the comparative analysis of mammalian transcriptional regulation in differentiation and development. PMID: [16141072] 

2. The National Institutes of Health's Mammalian Gene Collection (MGC) project was designed to generate and sequence a publicly accessible cDNA resource containing a complete open reading frame (ORF) for every human and mouse gene. The project initially used a random strategy to select clones from a large number of cDNA libraries from diverse tissues. Candidate clones were chosen based on 5'-EST sequences, and then fully sequenced to high accuracy and analyzed by algorithms developed for this project. Currently, more than 11,000 human and 10,000 mouse genes are represented in MGC by at least one clone with a full ORF. The random selection approach is now reaching a saturation point, and a transition to protocols targeted at the missing transcripts is now required to complete the mouse and human collections. Comparison of the sequence of the MGC clones to reference genome sequences reveals that most cDNA clones are of very high sequence quality, although it is likely that some cDNAs may carry missense variants as a consequence of experimental artifact, such as PCR, cloning, or reverse transcriptase errors. Recently, a rat cDNA component was added to the project, and ongoing frog (Xenopus) and zebrafish (Danio) cDNA projects were expanded to take advantage of the high-throughput MGC pipeline. PMID: [15489334] 

3. Kinases play a prominent role in tumor development, pointing to the presence of specific phosphorylation patterns in tumor tissues. Here, we investigate whether recently developed high resolution mass spectrometric (MS) methods for proteome and phosphoproteome analysis can also be applied to solid tumors. As tumor model, we used TG3 mutant mice carrying skin melanomas. At total of 100 microg of solid tumor lysate yielded a melanoma proteome of 4443 identified proteins, including at least 88 putative melanoma markers previously found by cDNA microarray technology. Analysis of 2 mg of lysate from dissected melanoma with titansphere chromatography and 8 mg with strong cation exchange together resulted in the identification of more than 5600 phosphorylation sites on 2250 proteins. The phosphoproteome included many hits from pathways important in melanoma. One-month storage at -80 degrees C did not significantly decrease the number of identified phosphorylation sites. Thus, solid tumor can be analyzed by MS-based proteomics with similar efficiency as cell culture models and in amounts compatible with biopsies. PMID: [19367708] 

4. The human ZC3H14 gene encodes an evolutionarily conserved Cys(3)His zinc finger protein that binds specifically to polyadenosine RNA and is thus postulated to modulate post-transcriptional gene expression. Expressed sequence tag (EST) data predicts multiple splice variants of both human and mouse ZC3H14. Analysis of ZC3H14 expression in both human cell lines and mouse tissues confirms the presence of multiple alternatively spliced transcripts. Although all of these transcripts encode protein isoforms that contain the conserved C-terminal zinc finger domain, suggesting that they could all bind to polyadenosine RNA, they differ in other functionally important domains. Most of the alternative transcripts encode closely related proteins (termed isoforms 1, 2, 3, and 3 short) that differ primarily in the inclusion of three small exons, 9, 10, and 11, resulting in predicted protein isoforms ranging from 82 to 64 kDa. Each of these closely related isoforms contains predicted classical nuclear localization signals (cNLS) within exons 7 and 11. Consistent with the presence of these putative nuclear targeting signals, these ZC3H14 isoforms are all localized to the nucleus. In contrast, an additional transcript encodes a smaller protein (34 kDa) with an alternative first exon (isoform 4). Consistent with the absence of the predicted cNLS motifs located in exons 7 and 11, ZC3H14 isoform 4 is localized to the cytoplasm. Both EST data and experimental data suggest that this variant is enriched in testes and brain. Using an antibody that detects endogenous ZC3H14 isoforms 1-3 reveals localization of these isoforms to nuclear speckles. These speckles co-localize with the splicing factor, SC35, suggesting a role for nuclear ZC3H14 in mRNA processing. Taken together, these results demonstrate that multiple transcripts encoding several ZC3H14 isoforms exist in vivo. Both nuclear and cytoplasmic ZC3H14 isoforms could have distinct effects on gene expression mediated by the common Cys(3)His zinc finger polyadenosine RNA binding domain. PMID: [19303045] 

Back to Top
Function
Binds the polyadenosine RNA oligonucleotides (Bysimilarity). 
Back to Top
Subcellular Location
Nucleus speckle. 
Tissue Specificity
Expressed in kidney, liver, muscle, heartbrain and testes. 
Gene Ontology
GO IDGO termEvidence
GO:0016607 C:nuclear speck IEA:UniProtKB-SubCell.
GO:0005634 C:nucleus ISS:UniProtKB.
GO:0003723 F:RNA binding IEA:UniProtKB-KW.
GO:0008270 F:zinc ion binding IEA:InterPro.
Back to Top
Interpro
IPR000571;    Znf_CCCH.
Back to Top
Pfam
SMART
SM00356;    ZnF_C3H1;    3.
Back to Top
PROSITE
PS50103;    ZF_C3H1;    3.
Back to Top
PRINTS
Created Date
18-Oct-2012 
Record Type
GAS predicted 
Sequence Annotation
CHAIN         1    735       Zinc finger CCCH domain-containing
                             protein 14.
                             /FTId=PRO_0000331313.
ZN_FING     595    620       C3H1-type 1.
ZN_FING     621    640       C3H1-type 2.
ZN_FING     641    656       C3H1-type 3.
ZN_FING     681    698       C3H1-type 4.
ZN_FING     700    718       C3H1-type 5.
MOD_RES       1      1       N-acetylmethionine (By similarity).
MOD_RES     357    357       N6-acetyllysine (By similarity).
MOD_RES     409    409       Phosphoserine (By similarity).
MOD_RES     450    450       Phosphoserine (By similarity).
MOD_RES     515    515       Phosphoserine.
MOD_RES     620    620       Phosphoserine (By similarity).
VAR_SEQ       1    295       Missing (in isoform 4).
                             /FTId=VSP_033177.
VAR_SEQ     296    426       LPVVSSVVKVKRFSHDGEEEEEDEDYGTRIGSLSSSVSVPA
                             KPERRPSLPPSKQANKNLILKAISEAQESVTKTTNYSAVPQ
                             KQTLPVAPRTRTSQEELLAEMVQGQNRAPRISPPVKEEEAK
                             GDNTGKSQ -> MKMSSRFSSPSLPVFLSPEPADLGSLTSA
                             SCSLNELGNISYLLRKIATDINEMKGMKAAILTVEANLFDL
                             NVRVSQNEAKISSLEVKMNEYLTSTSECNRQLEDFQERLEF
                             ESQSETTDANLIGFLTEVEK (in isoform 4).
                             /FTId=VSP_033178.
VAR_SEQ     427    582       Missing (in isoform 2).
                             /FTId=VSP_033179.
VAR_SEQ     452    582       Missing (in isoform 3 and isoform 4).
                             /FTId=VSP_033180.
CONFLICT     27     27       D -> H (in Ref. 1; BAC34134).
CONFLICT    665    665       T -> A (in Ref. 1; BAE36101).
Back to Top
Nucleotide Sequence
Length: 1248 bp   Go to nucleotide: FASTA
Protein Sequence
Length: 735 bp   Go to amino acid: FASTA
The verified Protein-Protein interaction information
UniProt
 Gene Symbol Ref Databases
Other Protein-Protein interaction resources
String database  
View Microarray data
Comments