Tag Content
SG ID
SG00007761 
UniProt Accession
Theoretical PI
6.45  
Molecular Weight
69753 Da  
Genbank Nucleotide ID
Genbank Protein ID
Gene Name
Asnsd1 
Gene Synonyms/Alias
 
Protein Name
Asparagine synthetase domain-containing protein 1 
Protein Synonyms/Alias
 
Organism
Mus musculus (Mouse) 
NCBI Taxonomy ID
10090 
Chromosome Location
chr:1;53382351-53409596;-1
View in Ensembl genome browser  
Function in Stage
Uncertain 
Function in Cell Type
Uncertain 
Probability (GAS) of Function in Spermatogenesis
0.887061145 
The probability was calculated by GAS algorithm, ranging from 0 to 1. The closer it is to 1, the more possibly it functions in spermatogenesis.
Description
Temporarily unavailable 
Abstract of related literatures
1. This study describes comprehensive polling of transcription start and termination sites and analysis of previously unidentified full-length complementary DNAs derived from the mouse genome. We identify the 5' and 3' boundaries of 181,047 transcripts with extensive variation in transcripts arising from alternative promoter usage, splicing, and polyadenylation. There are 16,247 new mouse protein-coding transcripts, including 5154 encoding previously unidentified proteins. Genomic mapping of the transcriptome reveals transcriptional forests, with overlapping transcription on both strands, separated by deserts in which few transcripts are observed. The data provide a comprehensive platform for the comparative analysis of mammalian transcriptional regulation in differentiation and development. PMID: [16141072] 

2. The National Institutes of Health's Mammalian Gene Collection (MGC) project was designed to generate and sequence a publicly accessible cDNA resource containing a complete open reading frame (ORF) for every human and mouse gene. The project initially used a random strategy to select clones from a large number of cDNA libraries from diverse tissues. Candidate clones were chosen based on 5'-EST sequences, and then fully sequenced to high accuracy and analyzed by algorithms developed for this project. Currently, more than 11,000 human and 10,000 mouse genes are represented in MGC by at least one clone with a full ORF. The random selection approach is now reaching a saturation point, and a transition to protocols targeted at the missing transcripts is now required to complete the mouse and human collections. Comparison of the sequence of the MGC clones to reference genome sequences reveals that most cDNA clones are of very high sequence quality, although it is likely that some cDNAs may carry missense variants as a consequence of experimental artifact, such as PCR, cloning, or reverse transcriptase errors. Recently, a rat cDNA component was added to the project, and ongoing frog (Xenopus) and zebrafish (Danio) cDNA projects were expanded to take advantage of the high-throughput MGC pipeline. PMID: [15489334] 

Back to Top
Function
 
Back to Top
Subcellular Location
 
Tissue Specificity
 
Gene Ontology
GO IDGO termEvidence
GO:0004066 F:asparagine synthase (glutamine-hydrolyzing) activity IEA:InterPro.
GO:0006529 P:asparagine biosynthetic process IEA:UniProtKB-KW.
GO:0006541 P:glutamine metabolic process IEA:UniProtKB-KW.
Back to Top
Interpro
IPR001962;    Asn_synthase.
IPR017932;    GATase_2_dom.
IPR000583;    GATase_dom.
IPR014729;    Rossmann-like_a/b/a_fold.
Back to Top
Pfam
PF00733;    Asn_synthase;    1.
PF13537;    GATase_7;    1.
Back to Top
SMART
PROSITE
PS51278;    GATASE_TYPE_2;    1.
Back to Top
PRINTS
Created Date
18-Oct-2012 
Record Type
GAS predicted 
Sequence Annotation
INIT_MET      1      1       Removed (By similarity).
CHAIN         2    627       Asparagine synthetase domain-containing
                             protein 1.
                             /FTId=PRO_0000324762.
DOMAIN        2    184       Glutamine amidotransferase type-2.
DOMAIN      308    597       Asparagine synthetase.
ACT_SITE      2      2       Nucleophile (By similarity).
VAR_SEQ     547    627       PFLDENVVSFLNSLPVWEKVDLTLPRGVGEKLILRLAAMEL
                             GLPASALLPKRAIQFGSRIAKLEKSNEKASDKCGRLQILP
                             -> AQHVPVPFATSLTMHMLSDFC (in isoform 2).
                             /FTId=VSP_032353.
CONFLICT     39     39       L -> I (in Ref. 1; BAE40074).
CONFLICT    117    117       G -> D (in Ref. 1; BAE40074).
CONFLICT    223    223       P -> Q (in Ref. 1; BAE40074).
CONFLICT    612    612       S -> F (in Ref. 2; AAH13617).
Back to Top
Nucleotide Sequence
Length: 2333 bp   Go to nucleotide: FASTA
Protein Sequence
Length: 627 bp   Go to amino acid: FASTA
The verified Protein-Protein interaction information
UniProt
Gene Symbol Ref Databases
Other Protein-Protein interaction resources
String database  
View Microarray data
Comments