Tag Content
SG ID
SG00010273 
UniProt Accession
Theoretical PI
5.77  
Molecular Weight
36108 Da  
Genbank Nucleotide ID
Genbank Protein ID
Gene Name
Gsg1 
Gene Synonyms/Alias
 
Protein Name
Germ cell-specific gene 1 protein 
Protein Synonyms/Alias
Germ cell-associated protein 1; 
Organism
Mus musculus (Mouse) 
NCBI Taxonomy ID
10090 
Chromosome Location
chr:6;135187347-135204354;-1
View in Ensembl genome browser  
Function in Stage
Uncertain 
Function in Cell Type
Uncertain 
Probability (GAS) of Function in Spermatogenesis
0.938485492 
The probability was calculated by GAS algorithm, ranging from 0 to 1. The closer it is to 1, the more possibly it functions in spermatogenesis.
Description
Temporarily unavailable 
Abstract of related literatures
1. We have cloned cDNAs involved in germ cell-specific expression. For this, a subtracted cDNA library was generated by subtracting cDNAs derived from supporting cells of mutant testis from wild-type testis cDNAs. Detailed analyses of mRNA expression revealed that the genes corresponding to the cloned cDNAs were exclusively expressed in testes and were developmentally controlled. PMID: [7957958] 


3. This study describes comprehensive polling of transcription start and termination sites and analysis of previously unidentified full-length complementary DNAs derived from the mouse genome. We identify the 5' and 3' boundaries of 181,047 transcripts with extensive variation in transcripts arising from alternative promoter usage, splicing, and polyadenylation. There are 16,247 new mouse protein-coding transcripts, including 5154 encoding previously unidentified proteins. Genomic mapping of the transcriptome reveals transcriptional forests, with overlapping transcription on both strands, separated by deserts in which few transcripts are observed. The data provide a comprehensive platform for the comparative analysis of mammalian transcriptional regulation in differentiation and development. PMID: [16141072] 

4. The mouse (Mus musculus) is the premier animal model for understanding human disease and development. Here we show that a comprehensive understanding of mouse biology is only possible with the availability of a finished, high-quality genome assembly. The finished clone-based assembly of the mouse strain C57BL/6J reported here has over 175,000 fewer gaps and over 139 Mb more of novel sequence, compared with the earlier MGSCv3 draft genome assembly. In a comprehensive analysis of this revised genome sequence, we are now able to define 20,210 protein-coding genes, over a thousand more than predicted in the human genome (19,042 genes). In addition, we identified 439 long, non-protein-coding RNAs with evidence for transcribed orthologs in human. We analyzed the complex and repetitive landscape of 267 Mb of sequence that was missing or misassembled in the previously published assembly, and we provide insights into the reasons for its resistance to sequencing and assembly by whole-genome shotgun approaches. Duplicated regions within newly assembled sequence tend to be of more recent ancestry than duplicates in the published draft, correcting our initial understanding of recent evolution on the mouse lineage. These duplicates appear to be largely composed of sequence regions containing transposable elements and duplicated protein-coding genes; of these, some may be fixed in the mouse population, but at least 40% of segmentally duplicated sequences are copy number variable even among laboratory mouse strains. Mouse lineage-specific regions contain 3,767 genes drawn mainly from rapidly-changing gene families associated with reproductive functions. The finished mouse genome assembly, therefore, greatly improves our understanding of rodent-specific biology and allows the delineation of ancestral biological functions that are shared with human from derived functions that are not. PMID: [19468303] 

5. The National Institutes of Health's Mammalian Gene Collection (MGC) project was designed to generate and sequence a publicly accessible cDNA resource containing a complete open reading frame (ORF) for every human and mouse gene. The project initially used a random strategy to select clones from a large number of cDNA libraries from diverse tissues. Candidate clones were chosen based on 5'-EST sequences, and then fully sequenced to high accuracy and analyzed by algorithms developed for this project. Currently, more than 11,000 human and 10,000 mouse genes are represented in MGC by at least one clone with a full ORF. The random selection approach is now reaching a saturation point, and a transition to protocols targeted at the missing transcripts is now required to complete the mouse and human collections. Comparison of the sequence of the MGC clones to reference genome sequences reveals that most cDNA clones are of very high sequence quality, although it is likely that some cDNAs may carry missense variants as a consequence of experimental artifact, such as PCR, cloning, or reverse transcriptase errors. Recently, a rat cDNA component was added to the project, and ongoing frog (Xenopus) and zebrafish (Danio) cDNA projects were expanded to take advantage of the high-throughput MGC pipeline. PMID: [15489334] 

6. Testis-specific poly(A) polymerase (TPAP) is a cytoplasmic poly(A) polymerase that is highly expressed in round spermatids. We identified germ cell-specific gene 1 (GSG1) as a TPAP interaction partner protein using yeast two-hybrid and coimmunoprecipitation assays. Subcellular fractionation analysis showed that GSG1 is exclusively localized in the endoplasmic reticulum (ER) of mouse testis where TPAP is also present. In NIH3T3 cells cotransfected with TPAP and GSG1, both proteins colocalize in the ER. Moreover, expression of GSG1 stimulates TPAP targeting to the ER, suggesting that interactions between the two proteins lead to the redistribution of TPAP from the cytosol to the ER. PMID: [18325338] 

Back to Top
Function
May cause the redistribution of PAPOLB from the cytosolto the endoplasmic reticulum. 
Back to Top
Subcellular Location
Endoplasmic reticulum membrane; Multi-passmembrane protein. Note=Colocalizes with PAPOLB in the endoplasmicreticulum. 
Tissue Specificity
Expressed in spermatogenic cells (at proteinlevel). Expressed in germ cells within the testis from day 21onwards. 
Gene Ontology
GO IDGO termEvidence
GO:0005783 C:endoplasmic reticulum IDA:MGI.
GO:0005789 C:endoplasmic reticulum membrane IEA:UniProtKB-SubCell.
GO:0016021 C:integral to membrane IEA:UniProtKB-KW.
Back to Top
Interpro
IPR012478;    GSG-1.
Back to Top
Pfam
PF07803;    GSG-1;    1.
Back to Top
SMART
PROSITE
PRINTS
Created Date
18-Oct-2012 
Record Type
GAS predicted 
Sequence Annotation
CHAIN         1    324       Germ cell-specific gene 1 protein.
                             /FTId=PRO_0000329462.
TRANSMEM     15     35       Helical; (Potential).
TRANSMEM    127    147       Helical; (Potential).
TRANSMEM    164    184       Helical; (Potential).
TRANSMEM    208    228       Helical; (Potential).
VAR_SEQ       1    107       Missing (in isoform 3).
                             /FTId=VSP_032999.
VAR_SEQ       1      4       MAKM -> M (in isoform 4).
                             /FTId=VSP_032998.
VAR_SEQ     108    125       EPGEKCRRFIELTPPAQR -> MEKASLLHLPWGPVAKVF
                             (in isoform 3).
                             /FTId=VSP_033000.
VAR_SEQ     125    125       R -> RGEKGLLEFATLQGSCHPTLRFGGEWLMEKASLLHL
                             PWGPVAKVF (in isoform 2 and isoform 4).
                             /FTId=VSP_033001.
CONFLICT    178    178       M -> I (in Ref. 3; BAC40258).
Back to Top
Nucleotide Sequence
Length: 1310 bp   Go to nucleotide: FASTA
Protein Sequence
Length: 324 bp   Go to amino acid: FASTA
The verified Protein-Protein interaction information
UniProt
Gene Symbol Ref Databases
Hspa5MINT 
PapolbMINT 
PapolbMINT 
Other Protein-Protein interaction resources
String database  
View Microarray data
Comments