SpermatogenesisOnline 1.0

Tag Content
SG ID
SG00013450 
UniProt Accession
Theoretical PI
6.18  
Molecular Weight
83985 Da  
Genbank Nucleotide ID
Genbank Protein ID
Gene Name
Adam32 
Gene Synonyms/Alias
 
Protein Name
Disintegrin and metalloproteinase domain-containing protein 32 
Protein Synonyms/Alias
ADAM 32Flags: Precursor 
Organism
Mus musculus (Mouse) 
NCBI Taxonomy ID
10090 
Chromosome Location
chr:8;25946612-26059276;-1
View in Ensembl genome browser  
Function in Stage
Uncertain 
Function in Cell Type
Uncertain 
Probability (GAS) of Function in Spermatogenesis
0.886380747 
The probability was calculated by GAS algorithm, ranging from 0 to 1. The closer it is to 1, the more possibly it functions in spermatogenesis.
Description
Temporarily unavailable 
Abstract of related literatures
1. This study describes comprehensive polling of transcription start and termination sites and analysis of previously unidentified full-length complementary DNAs derived from the mouse genome. We identify the 5' and 3' boundaries of 181,047 transcripts with extensive variation in transcripts arising from alternative promoter usage, splicing, and polyadenylation. There are 16,247 new mouse protein-coding transcripts, including 5154 encoding previously unidentified proteins. Genomic mapping of the transcriptome reveals transcriptional forests, with overlapping transcription on both strands, separated by deserts in which few transcripts are observed. The data provide a comprehensive platform for the comparative analysis of mammalian transcriptional regulation in differentiation and development. PMID: [16141072] 

2. The National Institutes of Health's Mammalian Gene Collection (MGC) project was designed to generate and sequence a publicly accessible cDNA resource containing a complete open reading frame (ORF) for every human and mouse gene. The project initially used a random strategy to select clones from a large number of cDNA libraries from diverse tissues. Candidate clones were chosen based on 5'-EST sequences, and then fully sequenced to high accuracy and analyzed by algorithms developed for this project. Currently, more than 11,000 human and 10,000 mouse genes are represented in MGC by at least one clone with a full ORF. The random selection approach is now reaching a saturation point, and a transition to protocols targeted at the missing transcripts is now required to complete the mouse and human collections. Comparison of the sequence of the MGC clones to reference genome sequences reveals that most cDNA clones are of very high sequence quality, although it is likely that some cDNAs may carry missense variants as a consequence of experimental artifact, such as PCR, cloning, or reverse transcriptase errors. Recently, a rat cDNA component was added to the project, and ongoing frog (Xenopus) and zebrafish (Danio) cDNA projects were expanded to take advantage of the high-throughput MGC pipeline. PMID: [15489334] 

3. Members of the ADAM (A Disintegrin And Metalloprotease) family of cell surface proteins have been discovered in a variety of tissues and species. We have cloned and sequenced a mouse cDNA encoding a novel member of the ADAM family. This mouse ADAM gene was named ADAM32 after an human homologue previously sequenced but not characterized. The cDNA sequence of ADAM32 has an open reading frame which encodes 750 (mouse ADAM32) and 787 (human ADAM32) amino acids, sharing 69% homology between the two species. The deduced amino acid sequences of mouse and human ADAM32 cDNAs contain all of the domains common to ADAM family members. Comparison of amino acid sequences showed that ADAM32 is highly homologous to ADAM2 and ADAM3, sperm surface proteins required for fertilization. We found that the ADAM32 gene is expressed predominantly in the testis. Examination of transcription in pre-pubertal and adult mouse testes revealed that expression of ADAM32 begins during meiotic prophase, in pachytene spermatocytes. These results suggest a potential role for ADAM32 in sperm development or fertilization. Genome database searches revealed that the mouse and human ADAM32 genes are located on chromosomes 8 and 8q11, respectively. The ADAM32 gene covers a relatively large region of the genome (120 kb for mouse ADAM32 and 180 kb for human ADAM32) and consists of multiple small exons (at least 22 exons in mouse ADAM32 and 25 exons in human ADAM32). PMID: [12568724] 

Back to Top
Function
May play a role in sperm development and fertilizationThis is a non-catalytic metalloprotease-like protein. 
Back to Top
Subcellular Location
Membrane; Single-pass type I membraneprotein (Potential). 
Tissue Specificity
Highly expressed in the testis and weaklyexpressed in the epididymis, brain and heart. 
Gene Ontology
GO IDGO termEvidence
GO:0016021 C:integral to membrane IEA:UniProtKB-KW.
GO:0004222 F:metalloendopeptidase activity IEA:InterPro.
GO:0008270 F:zinc ion binding IEA:InterPro.
GO:0006508 P:proteolysis IEA:InterPro.
Back to Top
Interpro
IPR006586;    ADAM_Cys-rich.
IPR001762;    Blood-coag_inhib_Disintegrin.
IPR000742;    EG-like_dom.
IPR006210;    EGF-like.
IPR013032;    EGF-like_CS.
IPR024079;    MetalloPept_cat_dom.
IPR001590;    Peptidase_M12B.
IPR002870;    Peptidase_M12B_N.
Back to Top
Pfam
PF08516;    ADAM_CR;    1.
PF00200;    Disintegrin;    1.
PF01562;    Pep_M12B_propep;    1.
PF01421;    Reprolysin;    1.
Back to Top
SMART
SM00608;    ACR;    1.
SM00050;    DISIN;    1.
SM00181;    EGF;    1.
Back to Top
PROSITE
PS50215;    ADAM_MEPRO;    1.
PS00427;    DISINTEGRIN_1;    FALSE_NEG.
PS50214;    DISINTEGRIN_2;    1.
PS00022;    EGF_1;    FALSE_NEG.
PS01186;    EGF_2;    1.
PS50026;    EGF_3;    1.
Back to Top
PRINTS
Created Date
18-Oct-2012 
Record Type
GAS predicted 
Sequence Annotation
SIGNAL        1     22       Potential.
PROPEP       23    176       Potential.
                             /FTId=PRO_0000029140.
CHAIN       177    754       Disintegrin and metalloproteinase domain-
                             containing protein 32.
                             /FTId=PRO_0000029141.
TOPO_DOM    177    689       Extracellular (Potential).
TRANSMEM    690    710       Helical; (Potential).
TOPO_DOM    711    754       Cytoplasmic (Potential).
DOMAIN      187    384       Peptidase M12B.
DOMAIN      391    483       Disintegrin.
DOMAIN      628    660       EGF-like.
COMPBIAS    484    506       Cys-rich.
MOD_RES      23     23       Phosphoserine (By similarity).
CARBOHYD    126    126       N-linked (GlcNAc...) (Potential).
CARBOHYD    362    362       N-linked (GlcNAc...) (Potential).
CARBOHYD    469    469       N-linked (GlcNAc...) (Potential).
CARBOHYD    570    570       N-linked (GlcNAc...) (Potential).
CARBOHYD    571    571       N-linked (GlcNAc...) (Potential).
DISULFID    296    379       By similarity.
DISULFID    338    363       By similarity.
DISULFID    340    345       By similarity.
DISULFID    454    475       By similarity.
DISULFID    632    642       By similarity.
DISULFID    636    648       By similarity.
DISULFID    650    659       By similarity.
VAR_SEQ     641    754       VCNSHGVCHCNAGYSPPNCQYPTTKRSASLWSGKHDLPMER
                             ASKNQEKKWLLSLYIVLIILASVFLIGTGWKGLKQCGSKEE
                             ESMSSESKSEDSTYTYVSRSTSETSSMTSTSS -> KQIRR
                             QHLHVCQQVSSLKDGVKRHVENEHHNFQPINF (in
                             isoform 2).
                             /FTId=VSP_012052.
CONFLICT    361    361       S -> I (in Ref. 3; AAN03858).
CONFLICT    728    728       E -> K (in Ref. 2; AAH60983).
Back to Top
Nucleotide Sequence
Length: 2235 bp   Go to nucleotide: FASTA
Protein Sequence
Length: 754 bp   Go to amino acid: FASTA
The verified Protein-Protein interaction information
UniProt
 Gene Symbol Ref Databases
Other Protein-Protein interaction resources
String database  
View Microarray data
Comments