Tag Content
SG ID
SG00021379 
UniProt Accession
Theoretical PI
9.75  
Molecular Weight
19553 Da  
Genbank Nucleotide ID
Genbank Protein ID
Gene Name
Cmtm2a 
Gene Synonyms/Alias
Cklfsf2a 
Protein Name
CKLF-like MARVEL transmembrane domain-containing protein 2A 
Protein Synonyms/Alias
Chemokine-like factor superfamily member 2A; 
Organism
Mus musculus (Mouse) 
NCBI Taxonomy ID
10090 
Chromosome Location
chr:8;106803853-106817078;-1
View in Ensembl genome browser  
Function in Stage
Uncertain 
Function in Cell Type
Uncertain 
Probability (GAS) of Function in Spermatogenesis
0.964088658 
The probability was calculated by GAS algorithm, ranging from 0 to 1. The closer it is to 1, the more possibly it functions in spermatogenesis.
Description
Temporarily unavailable 
Abstract of related literatures
1. This study describes comprehensive polling of transcription start and termination sites and analysis of previously unidentified full-length complementary DNAs derived from the mouse genome. We identify the 5' and 3' boundaries of 181,047 transcripts with extensive variation in transcripts arising from alternative promoter usage, splicing, and polyadenylation. There are 16,247 new mouse protein-coding transcripts, including 5154 encoding previously unidentified proteins. Genomic mapping of the transcriptome reveals transcriptional forests, with overlapping transcription on both strands, separated by deserts in which few transcripts are observed. The data provide a comprehensive platform for the comparative analysis of mammalian transcriptional regulation in differentiation and development. PMID: [16141072] 

2. The National Institutes of Health's Mammalian Gene Collection (MGC) project was designed to generate and sequence a publicly accessible cDNA resource containing a complete open reading frame (ORF) for every human and mouse gene. The project initially used a random strategy to select clones from a large number of cDNA libraries from diverse tissues. Candidate clones were chosen based on 5'-EST sequences, and then fully sequenced to high accuracy and analyzed by algorithms developed for this project. Currently, more than 11,000 human and 10,000 mouse genes are represented in MGC by at least one clone with a full ORF. The random selection approach is now reaching a saturation point, and a transition to protocols targeted at the missing transcripts is now required to complete the mouse and human collections. Comparison of the sequence of the MGC clones to reference genome sequences reveals that most cDNA clones are of very high sequence quality, although it is likely that some cDNAs may carry missense variants as a consequence of experimental artifact, such as PCR, cloning, or reverse transcriptase errors. Recently, a rat cDNA component was added to the project, and ongoing frog (Xenopus) and zebrafish (Danio) cDNA projects were expanded to take advantage of the high-throughput MGC pipeline. PMID: [15489334] 

Back to Top
Function
 
Back to Top
Subcellular Location
Membrane; Multi-pass membrane protein. 
Tissue Specificity
 
Gene Ontology
GO IDGO termEvidence
GO:0005737 C:cytoplasm IDA:MGI.
GO:0005615 C:extracellular space IEA:UniProtKB-KW.
GO:0016021 C:integral to membrane IEA:UniProtKB-KW.
GO:0005634 C:nucleus IPI:MGI.
GO:0003714 F:transcription corepressor activity IDA:MGI.
GO:0006935 P:chemotaxis IEA:UniProtKB-KW.
GO:0045892 P:negative regulation of transcription, DNA-dependent IDA:MGI.
GO:2000224 P:regulation of testosterone biosynthetic process IDA:MGI.
Back to Top
Interpro
IPR008253;    Marvel.
Back to Top
Pfam
SMART
PROSITE
PS51225;    MARVEL;    1.
Back to Top
PRINTS
Created Date
18-Oct-2012 
Record Type
GAS predicted 
Sequence Annotation
CHAIN         1    169       CKLF-like MARVEL transmembrane domain-
                             containing protein 2A.
                             /FTId=PRO_0000186099.
TRANSMEM     40     60       Helical; (Potential).
TRANSMEM     69     89       Helical; (Potential).
TRANSMEM     98    118       Helical; (Potential).
TRANSMEM    136    156       Helical; (Potential).
DOMAIN       40    162       MARVEL.
VAR_SEQ      97    101       YIPFV -> SEALG (in isoform 3).
                             /FTId=VSP_008253.
VAR_SEQ     102    169       Missing (in isoform 3).
                             /FTId=VSP_008254.
VAR_SEQ     107    168       DIFNSLFSCVFLGGGIYFAFKARRLLPKPYLTAMILMGAAA
                             ICSFIDMLLQFQHFRGLRLRK -> LLVSRDPSVLRKTTST
                             GGKEKRMQMRTFESRTHRRQSEKDGARVLSEGAEEISFSLV
                             KGKAR (in isoform 2).
                             /FTId=VSP_008255.
Back to Top
Nucleotide Sequence
Length: 329 bp   Go to nucleotide: FASTA
Protein Sequence
Length: 169 bp   Go to amino acid: FASTA
The verified Protein-Protein interaction information
UniProt
Gene Symbol Ref Databases
ArBioGRID 
ArBioGRID 
ArBioGRID 
ArBioGRID 
Other Protein-Protein interaction resources
String database  
View Microarray data
Comments